Alternative Name(s):

BTCProbetacellulin [Cleaved into: Betacellulin; BTC)]

Species: (Organism)

Homo sapiens (Human)

Gene Names:

BTC

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Expression Region:

32-178aa

Subcellular Location:

Betacellulin: Secreted, extracellular space, SUBCELLULAR LOCATION: Probetacellulin: Cell membrane, Single-pass type I membrane protein

Tissue Specificity:

Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.

Protein Length:

Full Length of Mature Protein

Pathway:

ErbBsignalingpathway

Mol. Weight:

43.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Involvement in disease:

Relevance:

Growth factor that binds to EGFR, ERBB4 and other EGF receptor family mbers. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

Solution structure of betacellulin, a new member of EGF-family ligands.Miura K., Doura H., Aizawa T., Tada H., Seno M., Yamada H., Kawano K.Biochem. Biophys. Res. Commun. 294:1040-1046(2002)