Alternative Name(s):

Osteogenic protein 1 ;OP-1INN: Eptotermin alfa

Species: (Organism)

Homo sapiens (Human)

Gene Names:

BMP7

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Expression Region:

293-431aa

Subcellular Location:

Secreted

Tissue Specificity:

Expressed in the kidney and bladder. Lower levels seen in the brain.

Protein Length:

Full Length of Mature Protein

Pathway:

Hipposignalingpathway

Mol. Weight:

42.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Developmental Biology

Function:

Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.

Involvement in disease:

Relevance:

Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

TGF-beta family

Reference:

Expression and characterization of a human BMP-7 variant with improved biochemical properties.Swencki-Underwood B., Mills J.K., Vennarini J., Boakye K., Luo J., Pomerantz S., Cunningham M.R., Farrell F.X., Naso M.F., Amegadzie B.Protein Expr. Purif. 57:312-319(2008)