Alternative Name(s):

Bcl2; Bcl-2; Apoptosis regulator Bcl-2

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Bcl2

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Expression Region:

5-205aa

Subcellular Location:

Mitochondrion outer membrane, Single-pass membrane protein, Nucleus membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein

Tissue Specificity:

Expressed in a variety of tissues.

Protein Length:

Partial

Pathway:

Mol. Weight:

26.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release

Involvement in disease:

Relevance:

Suppresses apoptosis in a variety of cell systs including factor-dependent lymphohatopoietic and neural cells. Regulates cell death by controlling the mitochondrial mbrane permeability. Appears to function in a feedback loop syst with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Bcl-2 family

Reference:

Apoptosis factor EI24/PIG8 is a novel endoplasmic reticulum-localized Bcl-2-binding protein which is associated with suppression of breast cancer invasiveness.Zhao X., Ayer R.E., Davis S.L., Ames S.J., Florence B., Torchinsky C., Liou J.S., Shen L., Spanjaard R.A.Cancer Res. 65:2125-2129(2005)