Alternative Name(s):

Apolipoprotein C2

Species: (Organism)

Homo sapiens (Human)

Gene Names:

APOC2

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Expression Region:

23-101aa

Subcellular Location:

Secreted

Tissue Specificity:

Liver and intestine.

Protein Length:

Full Length of Mature Protein

Pathway:

Cholesterolmetabolism

Mol. Weight:

24.9 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Metabolism

Function:

Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.

Involvement in disease:

Hyperlipoproteinemia 1B (HLPP1B)

Relevance:

Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridic individuals, predominantly found in the VLDL and LDL.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Apolipoprotein C2 family

Reference:

The human preproapolipoprotein C-II gene. Complete nucleic acid sequence and genomic organization.Fojo S.S., Law S.W., Brewer H.B. Jr.FEBS Lett. 213:221-226(1987)