Alternative Name(s):

Adaptor protein complex AP-1 subunit sigma-1C;Adaptor-related protein complex 1 subunit sigma-1C;Clathrin assembly protein complex 1 sigma-1C small chain;Golgi adaptor HA1/AP1 adaptin sigma-1C subunit;Sigma 1C subunit of AP-1 clathrin;Sigma-adaptin 1C;Sigma1C-adaptin

Species: (Organism)

Homo sapiens (Human)

Gene Names:

AP1S3

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA

Expression Region:

1-104aa

Subcellular Location:

Golgi apparatus, Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, clathrin-coated pit

Tissue Specificity:

Widely expressed.

Protein Length:

Full Length of Isoform 3

Pathway:

Mol. Weight:

39.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking

Involvement in disease:

Psoriasis 15, pustular (PSORS15)

Relevance:

Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to mbranes and the recognition of sorting signals within the cytosolic tails of transmbrane cargo molecules. Involved in TLR3 trafficking .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Adaptor complexes small subunit family

Reference:

AP1S3 mutations are associated with pustular psoriasis and impaired Toll-like receptor 3 trafficking.Setta-Kaffetzi N., Simpson M.A., Navarini A.A., Patel V.M., Lu H.C., Allen M.H., Duckworth M., Bachelez H., Burden A.D., Choon S.E., Griffiths C.E., Kirby B., Kolios A., Seyger M.M., Prins C., Smahi A., Trembath R.C., Fraternali F. , Smith C.H., Barker J.N., Capon F.Am. J. Hum. Genet. 94:790-797(2014)