Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) CSB-EP001176HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Adipocyte acid phosphatase Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2) Red cell acid phosphatase 1
Species: (Organism)
Homo sapiens (Human)
Gene Names:
ACP1
Tag info:
N-terminal GST-tagged
Target Protein AA Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Expression Region:
1-158aa
Subcellular Location:
Cytoplasm
Tissue Specificity:
T-lymphocytes express only isoform 2.
Protein Length:
Full Length of Isoform 1
Pathway:
Mol. Weight:
45 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Cell Biology
Function:
Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Involvement in disease:
Relevance:
Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Low molecular weight phosphotyrosine protein phosphatase family
Reference:
"Human red cell acid phosphatase (ACP1). The amino acid sequence of the two isozymes Bf and Bs encoded by the ACP1*B allele." Dissing J., Johnsen A.H., Sensabaugh G.F. J. Biol. Chem. 266:20619-20625(1991)
