Alternative Name(s):

Keratinocyte-associated protein 1

Species: (Organism)

Homo sapiens (Human)

Gene Names:

PERP

Tag info:

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Expression Region:

1-193aa

Subcellular Location:

Cell junction, desmosome, Cell membrane, Multi-pass membrane protein

Tissue Specificity:

Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts.

Protein Length:

Full Length

Pathway:

p53signalingpathway

Mol. Weight:

41.4 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).

Involvement in disease:

Relevance:

Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

TMEM47 family

Reference:

"p53 regulates the expression of a novel four transmembrane protein --PERP/PIGPC1 in mouse and human prostate cancer." Goltsov A.A., Ren C., Wang J., Yang G., Tahir S., Li L., Timme T.L., Thompson T.C. Submitted (OCT-2000)