Alternative Name(s):

Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2

Species: (Organism)

Homo sapiens (Human)

Gene Names:

SLC5A2

Tag info:

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA

Expression Region:

1-102aa

Subcellular Location:

Membrane, Multi-pass membrane protein

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

30.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1

Involvement in disease:

Renal glucosuria (GLYS)

Relevance:

Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Sodium:solute symporter (SSF) (TC 2.A.21) family

Reference:

"Novel compound heterozygous mutations in SLC5A2 are responsible for autosomal recessive renal glucosuria." Calado J., Soto K., Clemente C., Correia P., Rueff J. Hum. Genet. 114:314-316(2004)