Recombinant Human Myelin proteolipid protein(PLP1) CSB-CF018202HU
Specifications
| 20ug / 100ug price = 20ug |
Alternative Name(s):
Lipophilin PLP
Species: (Organism)
Homo sapiens (Human)
Gene Names:
PLP1
Tag info:
N-terminal 10xHis-tagged
Target Protein AA Sequence:
GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
Expression Region:
2-277aa
Subcellular Location:
Cell membrane, Multi-pass membrane protein, Myelin membrane
Tissue Specificity:
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
35.5 kDa
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
Involvement in disease:
Leukodystrophy, hypomyelinating, 1 (HLD1); Spastic paraplegia 2, X-linked (SPG2)
Relevance:
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Myelin proteolipid protein family
Reference:
"Individual exons encode the integral membrane domains of human myelin proteolipid protein." Diehl H.-J., Schaich M., Budzinski R.-M., Stoffel W. Proc. Natl. Acad. Sci. U.S.A. 83:9807-9811(1986)
