Recombinant Human SWI/SNF complex subunit SMARCC1(SMARCC1) ,partial CSB-BP821715HU
Specifications
| 20ug / 100ug price = 20ug |
Alternative Name(s):
BRG1-associated factor 155 ;BAF155SWI/SNF complex 155KDA subunitSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1
Species: (Organism)
Homo sapiens (Human)
Gene Names:
SMARCC1
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL
Expression Region:
451-671aa
Subcellular Location:
Nucleus, Cytoplasm
Tissue Specificity:
Expressed in brain, heart, muscle, placenta, lung, liver, muscle, kidney and pancreas.
Protein Length:
Partial
Pathway:
Mol. Weight:
27.5 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Neuroscience
Function:
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. May stimulate the ATPase activity of the catalytic subunit of the complex
Involvement in disease:
Relevance:
Involved in transcriptional activation and repression of select genes by chromatin rodeling (alteration of DNA-nucleosome topology). May stimulate the ATPase activity of the catalytic subunit of the complex. Belongs to the neural progenitors-specific chromatin rodeling complex (npBAF complex) and the neuron-specific chromatin rodeling complex (nBAF complex). During neural development a switch from a st/progenitor to a post-mitotic chromatin rodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural st/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural st cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth .
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
SMARCC family
Reference:
N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)
