Bioworld Technology

Bioworld Technology is manufacturer of over 15,000 highly purified Monoclonal and Polyclonal Antibodies, Peptides, Proteins, and other related Research Products. Their products are used in all biological fields. An important focus in research taking place today is in work investigating Signal transduction pathways, Cardiac markers, Neuroscience as well as Stem cell research. Bioworld Technology is committed to providing customers with innovative research tools and to helping scientists determine the mechanisms of cell function and disease.
Bioworld Technology is one of the leading phospho-antibody manufacturers. They have produced over 500 phospho-antibodies for AKT, AMPK, GSK, STAT pathways. The peptides corresponding to each phospho-antibody have also been listed to help scientists.
All of their high quality antibodies, peptides and kits were tested in their own facility with original published pictures included. They have a commitment to customer service and offer 100% quality satisfaction. If our products do not match the results listed on the data sheet, we will help you to troubleshoot or refund for the full credit.
Bioworld Technology continues to manufacture product lines to the highest standards; and all of their scientists are dedicated to the mystery of the world of science.

RecombinantTSG,His,Human BK0334

The add to cart button will appear once you select the values above

Specifications

size	10μg / 50μg

Source:

HEK 293

Molecular Weight:

30-33 kDa, observed by reducing SDS-PAGE.

Purity:

> 95% as analyzed by SDS-PAGE and HPLC.

Biological activity:

Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is < 2 μg/ml of TSG.

AA Sequence:

HHHHHHHHCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDT PPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHH QNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIG PECIDYGSKTVKCMNCMF

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

Twisted gastrulation (TWSG1 or TSG) is a cysteine-rich 24 kDa glycoprotein. It is a secreted BMP binding protein that modulates BMP ligand availability in extracellular space. Human TSG shares 98% aa identity with mouse and rat TSG, and 99.5% aa identity with canine, equine, bovine and porcine TSG. Glycosylation and bioactivity of TWSG1 recombinant proteins vary markedly by cellular source. Non-glycosylated hTWSG1 made in E. coli has both reduced affinity for BMPs, as shown by surface plasmon resonance analysis, and reduced BMP inhibitory activity in a mandibular explant culture system compared to glycosylated proteins made in insect cells or mouse myeloma cells.Recombinant human Twisted Gastrulation (TSG), produced in HEK 293 cells is a polypeptide chain containing 211 amino acids. A fully biologically active molecule, rhTSG has a molecular mass of 30~33 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant Human Twisted Gastrulation (TSG), remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Twisted Gastrulation should be stable up to 1 week at 4°C or up to 2 months at -20°C.