Skip to main content

Bioworld Technology

Bioworld

Bioworld Technology is manufacturer of over 15,000 highly purified Monoclonal and Polyclonal Antibodies, Peptides, Proteins, and other related Research Products. Their products are used in all biological fields. An important focus in research taking place today is in work investigating Signal transduction pathways, Cardiac markers, Neuroscience as well as Stem cell research. Bioworld Technology is committed to providing customers with innovative research tools and to helping scientists determine the mechanisms of cell function and disease.
Bioworld Technology is one of the leading phospho-antibody manufacturers. They have produced over 500 phospho-antibodies for AKT, AMPK, GSK, STAT pathways. The peptides corresponding to each phospho-antibody have also been listed to help scientists. 
All of their high quality antibodies, peptides and kits were tested in their own facility with original published pictures included. They have a commitment to customer service and offer 100% quality satisfaction. If our products do not match the results listed on the data sheet, we will help you to troubleshoot or refund for the full credit.
Bioworld Technology continues to manufacture product lines to the highest standards; and all of their scientists are dedicated to the mystery of the world of science.


www.bioworlde.com 

RecombinantOSM,Mouse(HEK293-expressed) BK0326



The add to cart button will appear once you select the values above

Specifications

10μg / 50μg / 1mg

Source:

HEK 293

Molecular Weight:

10-40 kDa, observed by reducing SDS-PAGE.

Purity:

> 95% as analyzed by SDS-PAGE and HPLC.

Biological activity:

ED50 < 0.4 ng/ml, measured in a cell proliferation assay using NIH-3T3 cells.

AA Sequence:

ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRV LYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGY HRFMGSVGRVFREWDDGSTRSRR

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4°C or up to 2 months at -20°C.