Bioworld Technology

Bioworld Technology is manufacturer of over 15,000 highly purified Monoclonal and Polyclonal Antibodies, Peptides, Proteins, and other related Research Products. Their products are used in all biological fields. An important focus in research taking place today is in work investigating Signal transduction pathways, Cardiac markers, Neuroscience as well as Stem cell research. Bioworld Technology is committed to providing customers with innovative research tools and to helping scientists determine the mechanisms of cell function and disease.
Bioworld Technology is one of the leading phospho-antibody manufacturers. They have produced over 500 phospho-antibodies for AKT, AMPK, GSK, STAT pathways. The peptides corresponding to each phospho-antibody have also been listed to help scientists.
All of their high quality antibodies, peptides and kits were tested in their own facility with original published pictures included. They have a commitment to customer service and offer 100% quality satisfaction. If our products do not match the results listed on the data sheet, we will help you to troubleshoot or refund for the full credit.
Bioworld Technology continues to manufacture product lines to the highest standards; and all of their scientists are dedicated to the mystery of the world of science.

RecombinantMIP-1α/CCL3,Mouse BK0322

The add to cart button will appear once you select the values above

Specifications

size	5μg / 25μg

Source:

HEK 293

Molecular Weight:

7.8 kDa, observed by reducing SDS-PAGE.

Purity:

> 95% as analyzed by SDS-PAGE and HPLC.

Biological activity:

The EC50 value of mouse MIP-1α/CCL3 on Caˆ2+ mobilization assay in CHO-K1/Gα15/mCCR1 cells (human Gα15 and mouse CCR1 stably expressed in CHO-K1 cells) is less than 100 ng/ml.

AA Sequence:

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

MIP-1 alpha/CCL3, also known as LD78 alpha, is an inflammatory chemokine. MIP-1α belongs to the CCL chemokine family, and shares 68% homology with MIP-1β. The mature form of MIP-1α contains 69 amino acids, exists as dimers in solution, and tends to undergo reversible aggregation. The receptors of MIP-1αin vivo are mainly the G-protein coupled receptors CCR1 and CCR5. Upon stimulation by endogenous and exogenous agents such as Interleukin-1β, Interferon-γ, and lipoteichoic acid from gram-positive bacteria, monocytes are able to secrete significant amounts of MIP-1α. MIP-1α augments the adhesions of T lymphocytes, monocytes, and neutrophils to vascular cell adhesion molecule 1. Additionally, in wounds, MIP-1αchemoattracts macrophages in order to accelerate the tissue repair process.Recombinant Mouse MIP-1 alpha/CCL3 (rmMIP-1α) produced in HEK 293cells is a single polypeptide chain containing 69 amino acids. A fully biologically active molecule, rmMIP-1αhas a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant Mouse MIP-1α/CCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution Mouse MIP-1α/CCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.