Bioworld Technology

Bioworld Technology is manufacturer of over 15,000 highly purified Monoclonal and Polyclonal Antibodies, Peptides, Proteins, and other related Research Products. Their products are used in all biological fields. An important focus in research taking place today is in work investigating Signal transduction pathways, Cardiac markers, Neuroscience as well as Stem cell research. Bioworld Technology is committed to providing customers with innovative research tools and to helping scientists determine the mechanisms of cell function and disease.
Bioworld Technology is one of the leading phospho-antibody manufacturers. They have produced over 500 phospho-antibodies for AKT, AMPK, GSK, STAT pathways. The peptides corresponding to each phospho-antibody have also been listed to help scientists.
All of their high quality antibodies, peptides and kits were tested in their own facility with original published pictures included. They have a commitment to customer service and offer 100% quality satisfaction. If our products do not match the results listed on the data sheet, we will help you to troubleshoot or refund for the full credit.
Bioworld Technology continues to manufacture product lines to the highest standards; and all of their scientists are dedicated to the mystery of the world of science.

RecombinantI‑TAC/CXCL11,Human(HEK293-expressed) BK0319

The add to cart button will appear once you select the values above

Specifications

size	10μg / 50μg

Source:

HEK 293

Molecular Weight:

8.3 kDa, observed by reducing SDS-PAGE.

Purity:

> 98% as analyzed by SDS-PAGE.

Biological activity:

The EC50 value of human I‑TAC/CXCL11 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR3 cells (human Ga15 and human CXCR3 stably expressed in CHO-K1 cells) is less than 0.5 μg/ml.

AA Sequence:

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQ ARLIIKKVERKNF

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

Chemokine (C-X-C motif) ligand 11(CXCL11), also known as I-TAC and B-R1, is a small cytokine belonging to the CXC chemokine family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-9).This chemokine elicits its effects on target cells by interacting with chemokine receptor CXCR3 having a higher affinity than other ligands for this receptor such as CXCL9 and CXCL10. CXCL11 is chemotactic for activated T cells. The gene encoding CXCL11 has been mapped to chromosome 4. CXCL11 cDNA encodes a 94 amino acid residue precursor protein with a 21 amino acid residue putative signal sequence, which is cleaved to form the mature 73 amino acid residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. Mouse CXCL11 exhibits 68% sequence homology with human CXCL11.Recombinant human I-TAC/CXCL11 produced in HEK293 cells is a single non-glycosylated polypeptide chain containing 73amino acids. A fully biologically active molecule, rhI-TAC/CXCL11 has a molecular mass of 8.3 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100μg/ml.

Storage:

Lyophilized recombinant humanI‑TAC/ CXCL11 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, humanCXCL11/I‑TAC should be stable up to 1 week at 4°C or up to 2 months at -20°C.