Skip to main content

Bioworld Technology

Bioworld

Bioworld Technology is manufacturer of over 15,000 highly purified Monoclonal and Polyclonal Antibodies, Peptides, Proteins, and other related Research Products. Their products are used in all biological fields. An important focus in research taking place today is in work investigating Signal transduction pathways, Cardiac markers, Neuroscience as well as Stem cell research. Bioworld Technology is committed to providing customers with innovative research tools and to helping scientists determine the mechanisms of cell function and disease.
Bioworld Technology is one of the leading phospho-antibody manufacturers. They have produced over 500 phospho-antibodies for AKT, AMPK, GSK, STAT pathways. The peptides corresponding to each phospho-antibody have also been listed to help scientists. 
All of their high quality antibodies, peptides and kits were tested in their own facility with original published pictures included. They have a commitment to customer service and offer 100% quality satisfaction. If our products do not match the results listed on the data sheet, we will help you to troubleshoot or refund for the full credit.
Bioworld Technology continues to manufacture product lines to the highest standards; and all of their scientists are dedicated to the mystery of the world of science.


www.bioworlde.com 

RecombinantWISP-1,Human BK0295



The add to cart button will appear once you select the values above

Specifications

5μg / 25μg

Source:

CHO

Molecular Weight:

44-46 kDa, observed by reducing SDS-PAGE.

Purity:

> 95% as analyzed by SDS-PAGE.

Biological activity:

ED50<0.5 μg/ml, measured in a bioassay using ATDC5 cells in the presence of 50 ng/ml human BMP-2.

AA Sequence:

TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCD YSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQ WVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVD IHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFC NLSCRNPNDIFADLESYPDFSEIAN

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

WISP-1, also known as Wnt-1-inducible-signaling pathway protein 1, CCN4 and Wnt-1-induced secreted protein, is a cysteine-rich heparin-binding Glycoprotein belonging to the CCN protein family. It is expressed in many internal organs, such as the lung, kidney and spleen. WISP-1 binds to BMP-2 and enhances mesenchymal cell proliferation and osteoblastic differentiation. , WISP-1 has also been reported to attenuate p53-mediated apoptosis and inhibit TNF-induced cell death, suggesting it may play a role intumorigenesis.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant human WISP-1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human WISP-1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.