Source:

CHO

Molecular Weight:

8-10 kDa, observed by reducing SDS-PAGE.

Purity:

> 95% as analyzed by SDS-PAGE and HPLC.

Biological activity:

ED50 < 100 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells expressing CCR5.

AA Sequence:

ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

MIP-1 Alpha, also known as CCL3, G0S19-1 and SCYA3, is a small inducible monokine belonging to the intercrine beta (chemokine CC) family. It binds to CCR1, CCR4 and CCR5, and participates in the host response to invading pathogens by regulating the trafficking and activation of inflammatory cells, such as macrophages, lymphocytes, NK cells and dendritic cells. MIP-1 alpha polymorphisms are associated with HIV susceptibility or resistance. Recombinant MIP-1 alpha induces a dose-dependent inhibition of HIV and SIV infection.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant Human MIP-1 Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1 Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.