Bioworld Technology

Bioworld Technology is manufacturer of over 15,000 highly purified Monoclonal and Polyclonal Antibodies, Peptides, Proteins, and other related Research Products. Their products are used in all biological fields. An important focus in research taking place today is in work investigating Signal transduction pathways, Cardiac markers, Neuroscience as well as Stem cell research. Bioworld Technology is committed to providing customers with innovative research tools and to helping scientists determine the mechanisms of cell function and disease.
Bioworld Technology is one of the leading phospho-antibody manufacturers. They have produced over 500 phospho-antibodies for AKT, AMPK, GSK, STAT pathways. The peptides corresponding to each phospho-antibody have also been listed to help scientists.
All of their high quality antibodies, peptides and kits were tested in their own facility with original published pictures included. They have a commitment to customer service and offer 100% quality satisfaction. If our products do not match the results listed on the data sheet, we will help you to troubleshoot or refund for the full credit.
Bioworld Technology continues to manufacture product lines to the highest standards; and all of their scientists are dedicated to the mystery of the world of science.

RecombinantI-309/CCL1,Human(CHO-expressed) BK0221

The add to cart button will appear once you select the values above

Specifications

size	10μg / 50μg

Source:

CHO

Molecular Weight:

15 kDa, observed by reducing SDS-PAGE.

Purity:

> 98% as analyzed by SDS-PAGE.

Biological activity:

The EC50 value of human I-309/CCL1 on Caˆ2+ mobilization assay in CHO-K1/ G15/hCCR8 cells (human G15 and human CCR8 stably expressed in CHO-K1 cells) is less than 1 μg/ml.

AA Sequence:

KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQR HRKMLRHCPSKRK

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family of chemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, immature B cells and dendritic cells by interacting with the cell surface chemokine receptor CCR8. This chemokine resides in a large cluster of CC chemokines on human chromosome 17.Recombinant Human I-309/CCL1 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhI-309/CCL1 has a molecular mass of 15kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant Human I-309/CCL1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant human I-309/CCL1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.