Skip to main content

Bioworld Technology

Bioworld

Bioworld Technology is manufacturer of over 15,000 highly purified Monoclonal and Polyclonal Antibodies, Peptides, Proteins, and other related Research Products. Their products are used in all biological fields. An important focus in research taking place today is in work investigating Signal transduction pathways, Cardiac markers, Neuroscience as well as Stem cell research. Bioworld Technology is committed to providing customers with innovative research tools and to helping scientists determine the mechanisms of cell function and disease.
Bioworld Technology is one of the leading phospho-antibody manufacturers. They have produced over 500 phospho-antibodies for AKT, AMPK, GSK, STAT pathways. The peptides corresponding to each phospho-antibody have also been listed to help scientists. 
All of their high quality antibodies, peptides and kits were tested in their own facility with original published pictures included. They have a commitment to customer service and offer 100% quality satisfaction. If our products do not match the results listed on the data sheet, we will help you to troubleshoot or refund for the full credit.
Bioworld Technology continues to manufacture product lines to the highest standards; and all of their scientists are dedicated to the mystery of the world of science.


www.bioworlde.com 

RecombinantGRO-γ/CXCL3,Human(CHO-expressed) BK0217



The add to cart button will appear once you select the values above

Specifications

10μg / 50μg / 1mg

Source:

CHO

Molecular Weight:

9 kDa, observed by reducing SDS-PAGE.

Purity:

> 98% as analyzed by SDS-PAGE.

Biological activity:

The EC50 value of human GRO-gamma/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR2 cells (human Ga15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/ml.

AA Sequence:

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQ KIIEKILNKGSTN

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as GRO3 oncogene (GRO3), GRO protein gamma (GROg) and macrophage inflammatory protein-2-beta (MIP2b). CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of the cerebellum, during morphogenesis.Recombinant humanGRO-gamma/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhGRO-gamma/CXCL3 has a molecular mass of 9kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant Human GRO-gamma/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human GRO-gamma/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.