Bioworld Technology

Bioworld Technology is manufacturer of over 15,000 highly purified Monoclonal and Polyclonal Antibodies, Peptides, Proteins, and other related Research Products. Their products are used in all biological fields. An important focus in research taking place today is in work investigating Signal transduction pathways, Cardiac markers, Neuroscience as well as Stem cell research. Bioworld Technology is committed to providing customers with innovative research tools and to helping scientists determine the mechanisms of cell function and disease.
Bioworld Technology is one of the leading phospho-antibody manufacturers. They have produced over 500 phospho-antibodies for AKT, AMPK, GSK, STAT pathways. The peptides corresponding to each phospho-antibody have also been listed to help scientists.
All of their high quality antibodies, peptides and kits were tested in their own facility with original published pictures included. They have a commitment to customer service and offer 100% quality satisfaction. If our products do not match the results listed on the data sheet, we will help you to troubleshoot or refund for the full credit.
Bioworld Technology continues to manufacture product lines to the highest standards; and all of their scientists are dedicated to the mystery of the world of science.

RecombinantCINC-2α/CXCL3,Rat BK0189

The add to cart button will appear once you select the values above

Specifications

size	10μg / 50μg / 1mg

Source:

CHO

Molecular Weight:

7.6 kDa, observed by reducing SDS-PAGE.

Purity:

> 98% as analyzed by SDS-PAGE.

Biological activity:

The EC50 value of rat CINC‑2α/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/rCXCR2 cells (human G15 and ratCXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml.

AA Sequence:

RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as MIP2β (macrophage inflammatory protein 2 beta), or DCIP1 (dendritic cell inflammatory protein1) in mouse, CINC-2 (cytokineinduced neutrophil attractant 2) in rat, or GROγ (growthregulated oncogene gamma) in human. CXCL3 controls migration and adhesion of monocytes and mediates its effects on target cells by interacting with the cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates cerebellar granule neuron precursors toward the internal layers of the cerebellum during cerebellum morphogenesis. CXCL3 is a potential target for medulloblastoma therapy. CXCL3 is regulated transcriptionally by BTG2.Recombinant Rat CINC-2α/CXCL3 produced in CHO cells is a polypeptide chain containing 68 amino acids. A fully biologically active molecule, rrCINC-2α/CXCL3 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant Rat CINC-2α/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat CINC-2α/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.