Source:

Escherichia coli.

Molecular Weight:

3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids.

Purity:

>97% by SDS-PAGE and HPLC analyses.

Biological activity:

Data Not Available.

AA Sequence:

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Endotoxin:

Less than 1EU/g of rHuCNTF as determined by LAL method.

Formulation:

Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.

Background:

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.

Storage:

This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles.