HER2 / ErbB2 Rabbit pAb (APR24596N) APR24596N
Specifications
| 50µl / 100µl / 200µl |
Product info:
This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Alternative names:
ERBB2; CD340; HER-2; HER-2/neu; HER2; MLN 19; NEU; NGL; TKR1; erb-b2 receptor tyrosine kinase 2; HER2/ErbB2; ErbB2; MLN19
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cell membrane, Cytoplasm, Nucleus, Nucleus, Single-pass type I membrane protein, perinuclear region
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 1160 to the C-terminus of human HER2 / ErbB2 (NP_004439.2).
Positive control:
SK-BR-3, Mouse lung
AA Sequence:
ARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
Purification:
Affinity purification
Molecular weight:
Calculated MW: 62kDa/70kDa/97kDa/134kDa/136kDa/137kDa Observed MW: 185KDa
Form:
Liquid
Applications:
WB (Mus musculus, Homo sapiens)
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:100
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com