ULK1 Rabbit pAb (APR28313N) APR28313N

Product info:

Serine/threonine-protein kinase involved in autophagy in response to starvation. Acts upstream of phosphatidylinositol 3-kinase PIK3C3 to regulate the formation of autophagophores, the precursors of autophagosomes. Part of regulatory feedback loops in autophagy: acts both as a downstream effector and negative regulator of mammalian target of rapamycin complex 1 (mTORC1 via interaction with RPTOR. Activated via phosphorylation by AMPK and also acts as a regulator of AMPK by mediating phosphorylation of AMPK subunits PRKAA1, PRKAB2 and PRKAG1, leading to negatively regulate AMPK activity. May phosphorylate ATG13/KIAA0652 and RPTOR; however such data need additional evidences. Plays a role early in neuronal differentiation and is required for granule cell axon formation. May also phosphorylate SESN2 and SQSTM1 to regulate autophagy. Phosphorylates FLCN, promoting autophagy. Phosphorylates AMBRA1 in response to autophagy induction, releasing AMBRA1 from the cytoskeletal docking site to induce autophagosome nucleation.

Alternative names:

ULK1; ATG1; ATG1A; UNC51; Unc51.1; hATG1; ULk1

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cytoplasm, Preautophagosomal structure, cytosol

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 400-499 of human ULK1 (NP_003556.1).

Positive control:

RD, 293T, Mouse brain, Rat brain

AA Sequence:

RTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSPPAHAEHGGVLARKMSLGGG

Purification:

Affinity purification

Molecular weight:

Calculated MW: 112kDa Observed MW: 150KDa

Form:

Liquid

Applications:

WB (Spodoptera frugiperda, Mus musculus, Homo sapiens)

Dilution:

WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:10 - 1:100

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com