Molnova

Molnova is a global bio-tech enterprise, specializing in chemical and biological research products with service to meet the research needs of their global customers. Molnova has evolved into one of the biggest global compounds and peptides supplier with over 9000 products from over 20 singnaling pathways and 400 targets. They carry a broad product line over different research areas such as cancer, infection, immunology, neurosciences, apoptosis and metabolic disorder, etc.

Molnova offers a wide range of high quality research chemicals including novel life-science reagents, inhibitors, peptides, activator, APIs and natural compounds for scientific use. Molnova also provides cutting edge custom services including chemical synthesis, peptide synthesis, drug screening and contract research services. Innovation plays a key role in their company's progress. Molnova focuses on novel target and novel candidate compounds for pre-clinical drug research. Besides, bring more than 1000 new products each year to help their customers achieve their project.

Molnova has a talented team of scientists and technical staff with experience in the biotech and pharma industry. Molnova’s mission is to provide top-notch life sciences products, innovative solutions to scientists worldwide and hit your research to lead.

website: www.molnova.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

IL1β Rabbit pAb (APR18345N) APR18345N

The add to cart button will appear once you select the values above

Specifications

size	50µl / 100µl / 200µl

Product info:

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

Alternative names:

IL-1; IL1-BETA; IL1F2; IL1 beta; IL1B

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cytoplasm, Cytoplasmic vesicle, Lysosome, Secreted, autophagosome, cytosol, exosome

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 1-269 of human IL1β (NP_000567.1).

Positive control:

RAW264.7, Mouse lung, Mouse liver

AA Sequence:

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Purification:

Affinity purification

Molecular weight:

Calculated MW: 30kDa Observed MW: 17KDa

Form:

Liquid

Applications:

WB (Mouse embryonal fibroblast cell, HUVEC cells, Human corneal epithelial cells, Human cells, Homo sapiens, Mus musculus, Sus scrofa, Rattus norvegicus, Bos taurus, Escherichia coli) IHC (Mus musculus) IF (Mus musculus, Homo sapiens) IP (Homo sapiens, Mus musculus) ELISA (Mus musculus)

Dilution:

WB 1:500 - 1:2000 IF 1:50 - 1:200

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com