Skip to main content

Molnova

Molnova

Molnova is a global bio-tech enterprise, specializing in chemical and biological research products with service to meet the research needs of their global customers. Molnova has evolved into one of the biggest global compounds and peptides supplier with over 9000 products from over 20 singnaling pathways and 400 targets. They carry a broad product line over different research areas such as cancer, infection, immunology, neurosciences, apoptosis and metabolic disorder, etc.

Molnova offers a wide range of high quality research chemicals including novel life-science reagents, inhibitors, peptides, activator, APIs and natural compounds for scientific use. Molnova also provides cutting edge custom services including chemical synthesis, peptide synthesis, drug screening and contract research services. Innovation plays a key role in their company's progress. Molnova focuses on novel target and novel candidate compounds for pre-clinical drug research. Besides, bring more than 1000 new products each year to help their customers achieve their project.

Molnova has a talented team of scientists and technical staff with experience in the biotech and pharma industry. Molnova’s mission is to provide top-notch life sciences products, innovative solutions to scientists worldwide and hit your research to lead.

website: www.molnova.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Caspase-1 Rabbit pAb (APR17603N) APR17603N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms.

Alternative names:

CASP1; ICE; IL1BC; P45; caspase-1; Caspase 1

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cytoplasm

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 1-311 of human Caspase-1 (NP_150635.1).

Positive control:

THP-1

AA Sequence:

MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Purification:

Affinity purification

Molecular weight:

Calculated MW: 10kDa/29kDa/35kDa/42kDa/45kDa Observed MW: 48KDa/20-25KDa

Form:

Liquid

Applications:

IF (Human colon cancer cell, Mus musculus) WB (Human chronic myeloid leukemia cells, Mouse colon cancer cells, N9, Mus musculus, Homo sapiens, Rattus norvegicus, Danio rerio, Sus scrofa, Gallus gallus) IHC (Mus musculus, Rattus norvegicus, Homo sapiens)

Dilution:

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com