Skip to main content

Molnova

Molnova

Molnova is a global bio-tech enterprise, specializing in chemical and biological research products with service to meet the research needs of their global customers. Molnova has evolved into one of the biggest global compounds and peptides supplier with over 9000 products from over 20 singnaling pathways and 400 targets. They carry a broad product line over different research areas such as cancer, infection, immunology, neurosciences, apoptosis and metabolic disorder, etc.

Molnova offers a wide range of high quality research chemicals including novel life-science reagents, inhibitors, peptides, activator, APIs and natural compounds for scientific use. Molnova also provides cutting edge custom services including chemical synthesis, peptide synthesis, drug screening and contract research services. Innovation plays a key role in their company's progress. Molnova focuses on novel target and novel candidate compounds for pre-clinical drug research. Besides, bring more than 1000 new products each year to help their customers achieve their project.

Molnova has a talented team of scientists and technical staff with experience in the biotech and pharma industry. Molnova’s mission is to provide top-notch life sciences products, innovative solutions to scientists worldwide and hit your research to lead.

website: www.molnova.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Beclin 1 Rabbit pAb (APR27321N) APR27321N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.

Alternative names:

ATG6; VPS30; beclin1; Beclin 1; BECN1; beclin-1

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus, Mitochondrion, Mitochondrion membrane, Nucleus, Peripheral membrane protein, autophagosome, trans-Golgi network membrane

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1).

Positive control:

293T, HeLa, U-87MG, Mouse lung, Mouse testis, Mouse spleen, Rat lung

AA Sequence:

MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG

Purification:

Affinity purification

Molecular weight:

Calculated MW: 51kDa Observed MW: 60KDa

Form:

Liquid

Applications:

WB (C2C12, A549, Mouse kidney, U2OS, Saos-2, Human Isikawa , NPCs, Mus musculus, Pollen, Homo sapiens, Rattus norvegicus, Anatinae, Gallus gallus, Spodoptera frugiperda, Sus scrofa) IHC (A549, Mouse kidney, Mus musculus) IF (Pollen, Rattus norvegicus, Sus scrofa, Mus musculus)

Dilution:

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com