Skip to main content

Molnova

Molnova

Molnova is a global bio-tech enterprise, specializing in chemical and biological research products with service to meet the research needs of their global customers. Molnova has evolved into one of the biggest global compounds and peptides supplier with over 9000 products from over 20 singnaling pathways and 400 targets. They carry a broad product line over different research areas such as cancer, infection, immunology, neurosciences, apoptosis and metabolic disorder, etc.

Molnova offers a wide range of high quality research chemicals including novel life-science reagents, inhibitors, peptides, activator, APIs and natural compounds for scientific use. Molnova also provides cutting edge custom services including chemical synthesis, peptide synthesis, drug screening and contract research services. Innovation plays a key role in their company's progress. Molnova focuses on novel target and novel candidate compounds for pre-clinical drug research. Besides, bring more than 1000 new products each year to help their customers achieve their project.

Molnova has a talented team of scientists and technical staff with experience in the biotech and pharma industry. Molnova’s mission is to provide top-notch life sciences products, innovative solutions to scientists worldwide and hit your research to lead.

website: www.molnova.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

TSG101/VPS23 Rabbit pAb (APR23431N) APR23431N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.

Alternative names:

TSG10; VPS23; TSG101 / VPS23; TSG101

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cytoplasm, Late endosome membrane, Membrane, Nucleus, Peripheral membrane protein

Isotype:

IgG

Immunogen:

A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TSG101/VPS23 (NP_006283.1).

Positive control:

HeLa, MCF7, K-562, Mouse spinal cord, Rat heart, Rat lung

AA Sequence:

SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY

Purification:

Affinity purification

Molecular weight:

Calculated MW: 31kDa/43kDa Observed MW: 44kDa

Form:

Liquid

Applications:

WB (HEK293T, Homo sapiens, Mus musculus, Rattus norvegicus, Cynoglossus semilaevis, Gallus gallus)

Dilution:

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IP 1:50 - 1:200

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com