Skip to main content

Molnova

Molnova

Molnova is a global bio-tech enterprise, specializing in chemical and biological research products with service to meet the research needs of their global customers. Molnova has evolved into one of the biggest global compounds and peptides supplier with over 9000 products from over 20 singnaling pathways and 400 targets. They carry a broad product line over different research areas such as cancer, infection, immunology, neurosciences, apoptosis and metabolic disorder, etc.

Molnova offers a wide range of high quality research chemicals including novel life-science reagents, inhibitors, peptides, activator, APIs and natural compounds for scientific use. Molnova also provides cutting edge custom services including chemical synthesis, peptide synthesis, drug screening and contract research services. Innovation plays a key role in their company's progress. Molnova focuses on novel target and novel candidate compounds for pre-clinical drug research. Besides, bring more than 1000 new products each year to help their customers achieve their project.

Molnova has a talented team of scientists and technical staff with experience in the biotech and pharma industry. Molnova’s mission is to provide top-notch life sciences products, innovative solutions to scientists worldwide and hit your research to lead.

website: www.molnova.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Cyclin E1 Rabbit pAb (APR20774N) APR20774N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2, whose activity is required for cell cycle G1/S transition. This protein accumulates at the G1-S phase boundary and is degraded as cells progress through S phase. Overexpression of this gene has been observed in many tumors, which results in chromosome instability, and thus may contribute to tumorigenesis. This protein was found to associate with, and be involved in, the phosphorylation of NPAT protein (nuclear protein mapped to the ATM locus), which participates in cell-cycle regulated histone gene expression and plays a critical role in promoting cell-cycle progression in the absence of pRB.

Alternative names:

CCNE1; CCNE; pCCNE1; cyclin E1

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Nucleus

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human Cyclin E1 (NP_001229.1).

Positive control:

Mouse brain, Rat brain

AA Sequence:

AASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA

Purification:

Affinity purification

Molecular weight:

Calculated MW: 47kDa Observed MW: 47Kda

Form:

Liquid

Applications:

WB (Homo sapiens, Mus musculus, Capra hircus)

Dilution:

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com