Skip to main content

Molnova

Molnova

Molnova is a global bio-tech enterprise, specializing in chemical and biological research products with service to meet the research needs of their global customers. Molnova has evolved into one of the biggest global compounds and peptides supplier with over 9000 products from over 20 singnaling pathways and 400 targets. They carry a broad product line over different research areas such as cancer, infection, immunology, neurosciences, apoptosis and metabolic disorder, etc.

Molnova offers a wide range of high quality research chemicals including novel life-science reagents, inhibitors, peptides, activator, APIs and natural compounds for scientific use. Molnova also provides cutting edge custom services including chemical synthesis, peptide synthesis, drug screening and contract research services. Innovation plays a key role in their company's progress. Molnova focuses on novel target and novel candidate compounds for pre-clinical drug research. Besides, bring more than 1000 new products each year to help their customers achieve their project.

Molnova has a talented team of scientists and technical staff with experience in the biotech and pharma industry. Molnova’s mission is to provide top-notch life sciences products, innovative solutions to scientists worldwide and hit your research to lead.

website: www.molnova.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Rad51 Rabbit pAb (APR26384N) APR26384N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternative names:

RAD51; BRCC5; FANCR; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cytoplasm, Mitochondrion matrix, Nucleus, centrosome, cytoskeleton, microtubule organizing center, perinuclear region

Isotype:

IgG

Immunogen:

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Rad51 (NP_002866.2).

Positive control:

U-937, Mouse brain, Mouse ovary, Mouse testis, Rat testis

AA Sequence:

EAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDR

Purification:

Affinity purification

Molecular weight:

Calculated MW: 26kDa/31kDa/36kDa Observed MW: 37kDa

Form:

Liquid

Applications:

WB (Mouse adipose-derived stem cells, HCC827, Homo sapiens, Mus musculus) IF (Mouse adipose-derived stem cells, Homo sapiens) Co-IP (Homo sapiens) IHC (Homo sapiens)

Dilution:

WB 1:500 - 1:1000

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com