Rad51 Rabbit pAb (APR26384N) APR26384N
Specifications
| 50µl / 100µl / 200µl |
Product info:
The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
Alternative names:
RAD51; BRCC5; FANCR; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cytoplasm, Mitochondrion matrix, Nucleus, centrosome, cytoskeleton, microtubule organizing center, perinuclear region
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Rad51 (NP_002866.2).
Positive control:
U-937, Mouse brain, Mouse ovary, Mouse testis, Rat testis
AA Sequence:
EAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDR
Purification:
Affinity purification
Molecular weight:
Calculated MW: 26kDa/31kDa/36kDa Observed MW: 37kDa
Form:
Liquid
Applications:
WB (Mouse adipose-derived stem cells, HCC827, Homo sapiens, Mus musculus) IF (Mouse adipose-derived stem cells, Homo sapiens) Co-IP (Homo sapiens) IHC (Homo sapiens)
Dilution:
WB 1:500 - 1:1000
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
